Protein Info for Ga0059261_0934 in Sphingomonas koreensis DSMZ 15582

Annotation: SOS regulatory protein LexA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 TIGR00498: repressor LexA" amino acids 2 to 227 (226 residues), 166.8 bits, see alignment E=2.4e-53 PF01726: LexA_DNA_bind" amino acids 2 to 63 (62 residues), 53.7 bits, see alignment E=1.4e-18 PF00717: Peptidase_S24" amino acids 108 to 221 (114 residues), 98.3 bits, see alignment E=2.4e-32

Best Hits

Swiss-Prot: 79% identical to LEXA_SPHWW: LexA repressor (lexA) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 79% identity to swi:Swit_3216)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W9U2 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Ga0059261_0934 SOS regulatory protein LexA (Sphingomonas koreensis DSMZ 15582)
MLTKKQHELICFIADRLNETGVSPSFEEMKDALDLKSKSGVHRLISALEERGFLRRLPNR
ARALEVLRMPERAEPKKAVPAKDNVVTLARPAPQAANPSPANDVIEIPLHGRIAAGVPIE
ALEGSTMLPVPAALLGSGEHYALEVAGDSMVEAGIFDGDYALIRRQETARDGEIVVALIE
DSEATLKYFRNEGSMVRLDPANRAYDPQRYRPDQVRVQGRLAGLLRRY