Protein Info for Ga0059261_0646 in Sphingomonas koreensis DSMZ 15582

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 79 to 99 (21 residues), see Phobius details TIGR00460: methionyl-tRNA formyltransferase" amino acids 7 to 299 (293 residues), 234.6 bits, see alignment E=7.6e-74 PF00551: Formyl_trans_N" amino acids 7 to 187 (181 residues), 129.8 bits, see alignment E=1e-41 PF02911: Formyl_trans_C" amino acids 208 to 299 (92 residues), 57.3 bits, see alignment E=1.5e-19

Best Hits

Swiss-Prot: 69% identical to FMT_NOVAD: Methionyl-tRNA formyltransferase (fmt) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 69% identity to nar:Saro_2894)

MetaCyc: 46% identical to 10-formyltetrahydrofolate:L-methionyl-tRNAfMet N-formyltransferase (Escherichia coli K-12 substr. MG1655)
Methionyl-tRNA formyltransferase. [EC: 2.1.2.9]; 2.1.2.9 [EC: 2.1.2.9]

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.9

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8Y6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Ga0059261_0646 methionyl-tRNA formyltransferase (Sphingomonas koreensis DSMZ 15582)
VRKAQPMRIIFMGTPEFAVPTLNELVEAGHDVVAAYSQPPRAGGRRGKALTPSPVHARAQ
ALGIEVRTPLSFRKDPDAVAAFAALEADVAVVAAYGLILPVSVLEAPRLGCMNVHASLLP
RWRGAAPIQRAILAGDAETGVGIMQMEAGLDTGPVRLEGRTPVAGKTAGELTDELAAMGA
RLMVQVLADPDAYPSVAQAEDGVTYASKIDKAETRLDFAQDAEAVARQVLAFNPPGSFFE
AAGERVRVLAADIVEGGGSAGVVLDDALTIACGTGAIRPTSVQRAGRGVMTTTELLNGFP
IPAGTQL