Protein Info for Ga0059261_0645 in Sphingomonas koreensis DSMZ 15582

Annotation: DNA replication and repair protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR00615: recombination protein RecR" amino acids 3 to 195 (193 residues), 209.6 bits, see alignment E=1.6e-66 PF21176: RecR_HhH" amino acids 6 to 48 (43 residues), 41.2 bits, see alignment 2.9e-14 PF02132: RecR_ZnF" amino acids 55 to 73 (19 residues), 29.1 bits, see alignment (E = 1.7e-10) PF01751: Toprim" amino acids 80 to 164 (85 residues), 25.8 bits, see alignment E=2.5e-09 PF13662: Toprim_4" amino acids 80 to 170 (91 residues), 88.6 bits, see alignment E=6.5e-29 PF21175: RecR_C" amino acids 172 to 195 (24 residues), 44.5 bits, see alignment (E = 2.3e-15)

Best Hits

Swiss-Prot: 84% identical to RECR_SPHWW: Recombination protein RecR (recR) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K06187, recombination protein RecR (inferred from 86% identity to sjp:SJA_C1-24540)

MetaCyc: 42% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W928 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Ga0059261_0645 DNA replication and repair protein RecR (Sphingomonas koreensis DSMZ 15582)
MASPEIETLTQALSRLPGLGPRSARRAVLHLLKKRETALDPLLAALTAVSQRLATCSTCG
NVDTSDPCAICADPRRDTRQLCVVEEVADLWALERSRLFPGRFHVLGGKLSALDGVRPED
LAIDSLVSRVAAGGIDEVVLAMNATLEGQTTAHYIAERLEGRPVRLTQLAHGLPVGGELD
YLDEGTLAQALRARRPVA