Protein Info for Ga0059261_0643 in Sphingomonas koreensis DSMZ 15582

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF02646: RmuC" amino acids 140 to 432 (293 residues), 324.8 bits, see alignment E=2.3e-101

Best Hits

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 55% identity to sch:Sphch_1915)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W907 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Ga0059261_0643 Uncharacterized protein conserved in bacteria (Sphingomonas koreensis DSMZ 15582)
VTLEFALALIFALLVGGAAGWFVAARRIAEIRAERDKREADFKAAIIDLAGADERLRELP
ELRDQLDSIRDERDIARLELTELRTKASTFEERLEEFKGARELMAGQFRELAGQMLSQTQ
EAFLKRAEDRFRQSEVTAGQNLKALLQPVNERLQRYEEGVAKVEAERRDAFGELKGQIEQ
MRIGQERVSSEAAKLVNSLRNAPKSRGRWGEQQLKNVLETCGLSEHTDFETEVSVAQEEG
GRLRPDAIVRVPGGKALVIDAKVSLNAYQDAFGAVEEGERQAGLAQHAAAMKAHVNALGN
KAYWTQFEDAPDYVIMFVPGEHFLSAALEHDHSLWDFAFEKRVLLATPTNLIAIARTVAA
VWRQEKLAKEARQIGELGKELYDRLAKAMGDLRLVGSGLNSAVKNFNTFASSLETRALVS
ARKLKELNVETGAREIESVASVELLASHAETPDADEAPAQAAE