Protein Info for Ga0059261_0530 in Sphingomonas koreensis DSMZ 15582

Annotation: 4-carboxy-2-hydroxymuconate semialdehyde dehydrogenase (EC 1.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF01408: GFO_IDH_MocA" amino acids 1 to 120 (120 residues), 86.7 bits, see alignment E=2.1e-28 PF19858: OxRdtase_C" amino acids 150 to 311 (162 residues), 302.3 bits, see alignment E=5.8e-95

Best Hits

Swiss-Prot: 80% identical to LIGC_SPHSK: 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (ligC) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K10219, 2-hydroxy-4-carboxymuconate semialdehyde hemiacetal dehydrogenase [EC: 1.1.1.312] (inferred from 84% identity to bsb:Bresu_2113)

MetaCyc: 80% identical to LigC (Sphingomonas sp. SYK6)
1.2.1.45-RXN [EC: 1.1.1.312]

Predicted SEED Role

"4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.312

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8P1 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Ga0059261_0530 4-carboxy-2-hydroxymuconate semialdehyde dehydrogenase (EC 1.1.1.-) (Sphingomonas koreensis DSMZ 15582)
MKIALAGAGAFGEKHLDGLRNIDGVEVISVVGRRLEPTQKVADKYGIPHATTELVEALEQ
PGLDAVILCTPTQMHAAQAIQCMDAGKHVQVEIPLCDSLADGEAVLAKAQETGLTCMVGH
TRRFNPSHQYLHRRIMAGELAVQQMDVQTYFFRRKNMNAKGEARSWTDHLLWHHAAHTVD
LFAYQAGPIVAANAIEGPHHPELGIAMDMSLQLKAESGAICTLSLSFNNDGPLGTFFRYI
CDNGTWIARYDDLVTGKEEPVDLTGVTVTSNGIELQDREFIAAIREGREPNASVAQVLPC
YRVLDALEKQLEAAR