Protein Info for Ga0059261_0435 in Sphingomonas koreensis DSMZ 15582

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 52 to 365 (314 residues), 228.4 bits, see alignment E=5.3e-72 PF16576: HlyD_D23" amino acids 65 to 287 (223 residues), 61.7 bits, see alignment E=1.3e-20 PF13533: Biotin_lipoyl_2" amino acids 65 to 110 (46 residues), 40.6 bits, see alignment 3.5e-14 PF13437: HlyD_3" amino acids 176 to 284 (109 residues), 30.2 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: None (inferred from 51% identity to dia:Dtpsy_1152)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8W8E5 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Ga0059261_0435 RND family efflux transporter, MFP subunit (Sphingomonas koreensis DSMZ 15582)
MRKSRVAAALGAILATGLAIFWMRGPASEEQATAPAPPMVLAAPVVVQDHIPRATYTGRL
TAVETVDLKPRVSGYITDVTVPEGQMVRRGQILFRLDSVPFAARHAAARAATREAEARLG
LAQAEDVRARRLVAEGVAARERSDVTTATLREREAQVASARAAERLAALDLRYAGVEAPI
AGRVGQILVTRGNLVAGGEAATPLTTIVSVDPLHVEFDVDEATYLRSLADRRSQSAETRV
GVRLEDGSTRSARLDFIGNRLDRATGTIRARAILPNPGGRLAPGLFAQVDVATANIRPAL
LVSDLAIGIEQGRRFVLVIGAKNMTEYRPVTLGPVVGGLRVIETGLRPGDRVVVKGLAGP
GMAVKPRIVPMPRGNGVQKNSVQPEAAR