Protein Info for Ga0059261_0351 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): N-acetylglutamylphosphate reductase (EC 1.2.1.38)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01850.
Original annotation: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01851: N-acetyl-gamma-glutamyl-phosphate reductase
  • amino acids 4 to 301 (298 residues), 383.2 bits, E=4.8e-119
• PF01118: Semialdhyde_dh
  • amino acids 44 to 102 (59 residues), 35 bits, E=8.7e-13

Best Hits

Swiss-Prot: 55% identical to ARGC_CAUVN: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 64% identity to sjp:SJA_C1-12610)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

See A0A2M8W870 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Ga0059261_0351 N-acetylglutamylphosphate reductase (EC 1.2.1.38) (Sphingomonas koreensis DSMZ 15582)
MSVSVFIDGAAGTTGLEIRERLATRSDISLIGLDDAHRKDAGKRAEAINSADFVILCLPD
DAAREAVALIANDTTRVIDASTAHRVADGWTYGFAELEPAQAAAIAEARYVSNPGCWPTG
FLALVRPLVRAGLIPPDWVLTAGGASGYSGGGKSMIAEFEDGSEPTGFRAYGLDLEHKHL
PEMQKHARIDHAPIFQPAVARSYRGMLIEVPLPLQMLPRKPAPAQIEQVLADAYRDSPIV
RVLPSDDVSLVRIEDDAGTDRLTIRVFGNAERGQARLVATLDNLGKGAGGAAVQNLNIMA
GFDQTAGLVL