Protein Info for PGA1_c10140 in Phaeobacter inhibens DSM 17395

Annotation: acetylornithine deacetylase ArgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR01892: acetylornithine deacetylase (ArgE)" amino acids 9 to 383 (375 residues), 375 bits, see alignment E=2e-116 PF01546: Peptidase_M20" amino acids 71 to 384 (314 residues), 108.5 bits, see alignment E=4.5e-35 PF07687: M20_dimer" amino acids 174 to 286 (113 residues), 56.6 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 77% identity to sil:SPO2812)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.16

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVD5 at UniProt or InterPro

Protein Sequence (388 amino acids)

>PGA1_c10140 acetylornithine deacetylase ArgE (Phaeobacter inhibens DSM 17395)
MADQLTPLEIMTKLISFPTVSSETNLPLVDWVEGYLASHGITAHRWVDPDQPHKAAVFAH
VGPDVEGAVVLSGHTDVVPIEGQPWDSDPFTVVERDGKYFGRGTCDMKGFDALAIWALVA
AHHRGVARPLQLALSFDEEVGCTGAPPMIVAMQDVLPKGSCVIVGEPSVMRPVTGHKGGI
GYSTHLVGFEVHSSLMHTGVSAIMQGARLIDWANARNAENMAKTPDDVAALFTPPFTTCH
VGMINGGTAHNITAKDCRFVMDFRVVPGESAAEWEAAYLAKVRDIEAEMQVVHPDTRIDV
SKKFNVPGLVPEVEGEAETLVRALTGDNGTHVVSYGTEAGQFQEAGYSAVICGPGDIAQA
HQPNEYIDVSQFNAGHRFMQQLIDRLAI