Protein Info for PGA1_c10130 in Phaeobacter inhibens DSM 17395

Annotation: glutathione import ATP-binding protein GsiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF00005: ABC_tran" amino acids 26 to 191 (166 residues), 101.5 bits, see alignment E=1.3e-32 amino acids 328 to 479 (152 residues), 106.1 bits, see alignment E=4.9e-34 PF13304: AAA_21" amino acids 146 to 226 (81 residues), 31 bits, see alignment E=5.1e-11 PF08352: oligo_HPY" amino acids 242 to 277 (36 residues), 28.1 bits, see alignment 4.4e-10 amino acids 531 to 566 (36 residues), 34.6 bits, see alignment 4.1e-12

Best Hits

Swiss-Prot: 53% identical to GSIA_SALPA: Glutathione import ATP-binding protein GsiA (gsiA) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 89% identity to sit:TM1040_0716)

Predicted SEED Role

"peptide/nickel/opine uptake family ABC transporter, ATP-binding protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DNT5 at UniProt or InterPro

Protein Sequence (606 amino acids)

>PGA1_c10130 glutathione import ATP-binding protein GsiA (Phaeobacter inhibens DSM 17395)
MLDQPIAQIKGLRVEFQTKDGPVVGVKDVSFDVNPGETVCIVGESGSGKSVSSLSLMRLV
EFGGGDITSGQLLFDRRDGSEVDLGKTDQSLMKQIRGNEIGMIFQEPMTALNPVFTVGRQ
LTEGLRVHKNMTKKEAETRALELLREVRIPEPERRLKQYPHELSGGMRQRVVIAMAMACE
PRLLIADEPTTALDVTIQAEILALMDRLKRETGTAVMFITHDMAVVAQMADRVVVMFRGN
KVEEGTVNEIFENPQHDYTKSLLAAVPKLGEMRGKDYPEPMKLMGVEQQEIAPIKGSDEV
LLEVRNLVTRFPVKGGILRRTVANVHAVEDVSFKVFKGQTLSLVGESGCGKSSAGRSLLR
LVEPQSGAVEFEGRDILGLNQSELHKARLDMQMIFQDPFASLNPQMQLLDQVAEPMRNYG
LASGSELQDRVANLFDRVHLPRSFMRRYPHEMSGGQRQRIAIARALALNPKLIVADEAVS
ALDVSVQAQVLNLMMELQAELGLSFLFISHDMAVVERVSHQVGVMYLGRIVELGPRARVF
ENPQHAYTQALMKAVPIADPNQRKSEKDLNFKPIPSPIHDLNYQPEPSQYIEVEPGHFVL
TTDSGY