Protein Info for PGA1_c10110 in Phaeobacter inhibens DSM 17395

Annotation: glutathione transport system permease protein GsiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 116 to 139 (24 residues), see Phobius details amino acids 151 to 178 (28 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 116 (116 residues), 45.4 bits, see alignment E=8.8e-16 PF00528: BPD_transp_1" amino acids 130 to 333 (204 residues), 129 bits, see alignment E=1.8e-41

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 96% identity to sil:SPO2815)

Predicted SEED Role

"Peptide/nickel/opine uptake family ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZ37 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PGA1_c10110 glutathione transport system permease protein GsiC (Phaeobacter inhibens DSM 17395)
MLTFTIRRLVLSVPTLLFISLVIFLLLELAPGDPMAQVPLTVPPEVKEKMREALGLGQPA
HIRFWKWIVQFFWIEPQVLIDHYFGTSFSAGDLRVISWQTRSPVMDIVVQRMPQTLWVVG
TAYLVAIAIALPIGIYSAYRQYSWFDQVGTFVSMVGFSVPPFFSGVLVIVIFSVQLGWFP
SIYDTTHVVNSWDSFVKQLQQMVMPVMVLALQITAQLSRFMRASMLDNLNQDYVRTARAK
GLSEYVVVMVHVLRNSMIPVVTVIALGIPAIFGGAIITEQVFKVNGIGQLLIGAIEANDL
PMVQTLTFIFAVLIVLFNLIADVLYGILDPRIRYD