Protein Info for PGA1_c10060 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator, MerR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 PF13411: MerR_1" amino acids 1 to 59 (59 residues), 46.4 bits, see alignment E=3.5e-16 PF00376: MerR" amino acids 2 to 39 (38 residues), 52.9 bits, see alignment E=2.6e-18

Best Hits

Swiss-Prot: 30% identical to ADHR_BACSU: HTH-type transcriptional regulator AdhR (adhR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 53% identity to mag:amb3964)

Predicted SEED Role

"transcriptional regulator, MerR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZ32 at UniProt or InterPro

Protein Sequence (122 amino acids)

>PGA1_c10060 putative transcriptional regulator, MerR family (Phaeobacter inhibens DSM 17395)
MKISDVAMATGLSVDTLRFYEKIGLIDPPARDAAGQRVYDRDILGWIRFLGQLNATGMKQ
ADRVRYARLRAKGRETLAERREMLEAHREVIRRQLEQLHDTLALMDRKVAIYHDLEKESA
DV