Protein Info for Psest_1020 in Pseudomonas stutzeri RCH2

Annotation: acetyl-CoA carboxylase, biotin carboxyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein" amino acids 1 to 150 (150 residues), 198.4 bits, see alignment E=4.9e-63 PF00364: Biotin_lipoyl" amino acids 77 to 150 (74 residues), 91.7 bits, see alignment E=1.1e-30

Best Hits

Swiss-Prot: 82% identical to BCCP_PSEAE: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 98% identity to psa:PST_3273)

MetaCyc: 65% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFT6 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Psest_1020 acetyl-CoA carboxylase, biotin carboxyl carrier protein (Pseudomonas stutzeri RCH2)
MDIRKVKKLIELLEESGIDELEIHEGEESVRISRHSKQVAMQQPIYAQAPAAPAPAPVAA
APAADAAPAAPKLNGNVVRSPMVGTFYRASSPESKAFVEVGQSVKKGDILCIVEAMKMMN
HIEAEISGTIESILVENGQPVEYDQPLFTIV