Protein Info for PGA1_c10030 in Phaeobacter inhibens DSM 17395

Annotation: NAD(P) transhydrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 171 to 192 (22 residues), see Phobius details amino acids 415 to 434 (20 residues), see Phobius details amino acids 440 to 458 (19 residues), see Phobius details amino acids 465 to 484 (20 residues), see Phobius details amino acids 490 to 512 (23 residues), see Phobius details TIGR00561: NAD(P)(+) transhydrogenase (AB-specific), alpha subunit" amino acids 2 to 522 (521 residues), 668.5 bits, see alignment E=3.2e-205 PF05222: AlaDh_PNT_N" amino acids 4 to 139 (136 residues), 152.5 bits, see alignment E=1.3e-48 PF01262: AlaDh_PNT_C" amino acids 143 to 373 (231 residues), 218.9 bits, see alignment E=8.4e-69 PF12769: PNTB_4TM" amino acids 439 to 522 (84 residues), 106.1 bits, see alignment E=1.6e-34

Best Hits

Swiss-Prot: 77% identical to PNTA_RHOSH: NAD(P) transhydrogenase subunit alpha (pntA) from Rhodobacter sphaeroides

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 89% identity to sil:SPO2820)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DNS2 at UniProt or InterPro

Protein Sequence (523 amino acids)

>PGA1_c10030 NAD(P) transhydrogenase subunit alpha (Phaeobacter inhibens DSM 17395)
MKIGTPKEVFEGEARVAMTPDSAVQLQKLGYTCAIETGAGAAAGFADATYEAVGVEIVKT
PAALWKAADIVAKVRQPTETELKRMTAGKTLISFFNPGGNEAGMELARSKGANVIAMEMV
PRISRAQKMDALSSMANIAGYRAVIEAGNNFGRFFTGQITAAGKVPPAKVLVVGAGVAGL
AAIGASTSLGAITYAFDVRPEVAEQVESMGAEFVYLDFEESQQDGAATGGYAAVSSPEFR
EAQLAKFRELAPDVDIVITTALIPNREAPKLWLEDMVAAMKPGSVIIDLAAEKGGNVEGT
VMDEKVVTENGVTIIGYTDFPSRMAAQASTLYATNIRHMMTDLTPEKDGQINHDMEDDVI
RGATVTFEKEITFPPPPPKVQAIAAQPKKEVKELTPEEKRAQEVEAFKQQTKNQVTLLAV
GGALVLFVGLFAPASFMQHFIVFALACFVGFQVIWGVAHSLHTPLMAVTNAISSIIILGA
LMQIGSGSFLVIFLAALSVFMAGINIFGGFLVTRRMLAMFQKS