Protein Info for Psest_1016 in Pseudomonas stutzeri RCH2

Annotation: putative TIM-barrel protein, nifR3 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR00737: putative TIM-barrel protein, nifR3 family" amino acids 6 to 321 (316 residues), 422.9 bits, see alignment E=4.1e-131 PF01207: Dus" amino acids 16 to 313 (298 residues), 355.5 bits, see alignment E=1.2e-110

Best Hits

Swiss-Prot: 80% identical to DUSB_PSESM: tRNA-dihydrouridine synthase B (dusB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K05540, tRNA-dihydrouridine synthase B [EC: 1.-.-.-] (inferred from 94% identity to psa:PST_3277)

MetaCyc: 64% identical to tRNA-dihydrouridine synthase B (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJU6 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psest_1016 putative TIM-barrel protein, nifR3 family (Pseudomonas stutzeri RCH2)
MSAVRIGPYTLTNPLILAPMAGVTDQPFRQLCRRFGAALVVSEMLTSDMRLWNSRKSRLR
MPHADEPEPRSVQIAGGDPQMLADAARRNVELGAQIIDINMGCPAKKVCNKAAGSALMRD
ERLVGEILDAVVGAVDVPVTLKIRTGWDRQNKNGLTVARIAEQAGIAALAVHGRTRADLY
TGEAEYDTIAAIKQAVSIPVFANGDIDSPQKAAQVLRATGVDGLLIGRAAQGRPWIFREV
EHYLRTGELLAAPTLEEIEDTLLEHVQALHEFYGEVMGVRIARKHVGWYLATLPGARDFR
ARFNHLEDRDAQGFSIRQFFAEQRSGPGSVDGTEVAA