Protein Info for PGA1_c10000 in Phaeobacter inhibens DSM 17395

Annotation: short chain dehydrogenase / reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00106: adh_short" amino acids 6 to 186 (181 residues), 161.2 bits, see alignment E=3.4e-51 PF08659: KR" amino acids 9 to 153 (145 residues), 56.6 bits, see alignment E=5e-19 PF13561: adh_short_C2" amino acids 15 to 250 (236 residues), 151.8 bits, see alignment E=3.6e-48

Best Hits

Swiss-Prot: 31% identical to YXJF_BACSU: Uncharacterized oxidoreductase YxjF (yxjF) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 74% identity to sil:SPO2823)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EKI6 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PGA1_c10000 short chain dehydrogenase / reductase (Phaeobacter inhibens DSM 17395)
MTLKGKHALITGGGTGIGLAMAQALAAEGAEVTITGRRQEVLEEVATEGLHPLAMDVRDE
ADVIAKIDAATAARGPIQICVPNAGIAEGKALHKMSMEFWRNMMATNLDGAFLTIRESMK
SMRQTDWGRVMTVSSIAGLRGLQGAPCYSASKHGLIGLTRSLSEDYLGTPYTFNALCPGY
VDTPIIDRNVTSISQRAGVSEEDALKIMVSANRHKRLILPDEVAAALLWLCGPGSQSING
QTIEIAGGQT