Protein Info for Psest_0098 in Pseudomonas stutzeri RCH2

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 21 to 263 (243 residues), 304.9 bits, see alignment E=2.1e-95 PF00528: BPD_transp_1" amino acids 92 to 263 (172 residues), 75.4 bits, see alignment E=2.6e-25

Best Hits

Swiss-Prot: 74% identical to PHNE_ECOBD: Phosphonate transport system permease protein PhnE (phnE) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 86% identity to pae:PA3382)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFB3 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Psest_0098 phosphonate ABC transporter, permease protein PhnE (Pseudomonas stutzeri RCH2)
MTTLSTTPPLAGNDKRSWLRLLGWGLCLAVLAWSWQGAEMNPLLLIRDSANMATFAADFF
PPDFSNWQLYLKEMITTVHIALWGTLLAIVCAIPLGILSSENIVPWWVYQPVRRLMDACR
SINEMVFAMLFVVAVGLGPFAGVLALWISTTGVLAKLFAEAVEAIEPGPVEGVRATGASA
LQEVIFGVIPQVLPLWISYSLYRFESNVRSATVVGMVGAGGIGVILWEAIRGFQFGQTAA
LLLIIIAVVSLIDLCSQRLRKLFI