Protein Info for Psest_1009 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 26 to 43 (18 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 93% identity to psa:PST_3284)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFS8 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Psest_1009 hypothetical protein (Pseudomonas stutzeri RCH2)
MQPSPDQPDVMTDTTHTHAEHKPRPLIDLAVSILLPSLILMKLSGEERLGADGALLVALA
FPLGWGLWELAKYRKFNWIALLGLISVLLTGGIGLLQLDTQWLAVKEAAVPGIIGIAVLA
STRTRYPLIRTLLYNPKVLNVDKIHEQLEHNGQVEHFETRLLRATYLLSGTFFFSSFMNY
VLAKWIVNSPAGSEAFNAELGRMTLLSYPMIAIPSMLMMMAIFYYLWRTIHGLTGLRLED
IMAGAQEQSRSK