Protein Info for Psest_1002 in Pseudomonas stutzeri RCH2

Annotation: glutamyl-queuosine tRNA(Asp) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 23 to 40 (18 residues), see Phobius details TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 12 to 276 (265 residues), 358.5 bits, see alignment E=1.2e-111 PF00749: tRNA-synt_1c" amino acids 15 to 116 (102 residues), 95.3 bits, see alignment E=1.7e-31 amino acids 135 to 237 (103 residues), 51.6 bits, see alignment E=3.5e-18

Best Hits

Swiss-Prot: 81% identical to GLUQ_PSEMY: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 86% identity to psa:PST_3290)

MetaCyc: 50% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHV5 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Psest_1002 glutamyl-queuosine tRNA(Asp) synthetase (Pseudomonas stutzeri RCH2)
MPSATSAHTERYVGRFAPTPSGYLHFGSLVAALASYLDARAVGGRWLLRMEDIDPPREMP
GAQKAIIGTLISYGFEWDGEMLRQSERHDAYRDAIDRLLEQRLAYACTCSRKQLEAYPGP
YPGFCRTAGNGLDDAAIRLRVPDREYGFVDRVQGEFRQHLGREVGDFVIRRRDGLIAYQL
AVVLDDAWQGVTDVVRGADLLDSTPRQLYLQELLGLPQLRYLHLPLIIQPDGHKLGKSYR
SPPLQPHEASPLLLRALRALGQQPADELSDALPGEILTWAVRHWNADRIPRTRTLAEAQL
R