Protein Info for PGA1_c00990 in Phaeobacter inhibens DSM 17395

Annotation: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase FolK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01498: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
  • amino acids 9 to 160 (152 residues), 94.9 bits, E=2.2e-31
• PF01288: HPPK
  • amino acids 10 to 160 (151 residues), 102.3 bits, E=1.2e-33

Best Hits

KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 58% identity to sil:SPO3205)

Predicted SEED Role

"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis V (Pyrococcus) (1/4 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• superpathway of chorismate metabolism (36/59 steps found)
• tetrahydromethanopterin biosynthesis (2/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.3

Sequence Analysis Tools

See I7EVM5 at UniProt or InterPro

Protein Sequence (189 amino acids)

>PGA1_c00990 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase FolK (Phaeobacter inhibens DSM 17395)
MTEIRSEALIAMGGNLPIGEQSVVHTLIGAVEQLSESDIRLTAVSRFYRTPCFPAGSGPD
YVNAAIAIRTILSPRDLLDLLHQVEADFARRRVQRWGMRTLDLDLIAYDDLICPDVATFE
RWKDLPLEQQMQEAPGQMLVPHPRLQDRGFVLVPLRDIAPDWRHPILGQTVRELCAALPM
SDLNEISPV