Protein Info for Psest_0999 in Pseudomonas stutzeri RCH2

Annotation: Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF00072: Response_reg" amino acids 4 to 109 (106 residues), 80.1 bits, see alignment E=4.1e-26 PF00158: Sigma54_activat" amino acids 144 to 310 (167 residues), 248.1 bits, see alignment E=1.1e-77 PF14532: Sigma54_activ_2" amino acids 145 to 315 (171 residues), 89.3 bits, see alignment E=8.4e-29 PF07728: AAA_5" amino acids 167 to 286 (120 residues), 35.7 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_3293)

Predicted SEED Role

"Two-component sensor CbrB: intrcellular carbon:nitrogen balance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFR8 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Psest_0999 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Pseudomonas stutzeri RCH2)
MSHILIVEDETIIRSALRRLLERNQYEVSEAGSVQEAQERYSIPGFDLIVSDLRLPGAPG
TELIKLAEGTPVLIMTSYASLRSAVDSMKMGAVDYIAKPFDHDEMLQTVARILSDHQQSA
AVQAQPARSASATAAGSGRDDIGIIGHCAPMQDLFGKIRKVAPTDSNVLIQGESGTGKEL
VARALHNLSRRAKAPMISVNCAAIPETLIESELFGHEKGAFTGASAGRAGLVEAADGGTL
FLDEIGELPLEAQARLLRVLQEGEIRRVGSVQSQKVDVRLIAATHRDLKTLAKTGQFRED
LYYRLHVIALKLPPLRERGSDVLEIAKAFLARQGERMGSDDLHFSRDAEQAIRHYSWPGN
VRELENAIERAAILSESPEIDAELLGIDIELDELDDDFDEPLGSIRGIANSNEPTEDLSL
EDYFQHFVLEHQDHMTETELARKLGISRKCLWERRQRLGIPRRKSSSAAG