Protein Info for Psest_0995 in Pseudomonas stutzeri RCH2

Annotation: pantoate--beta-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 90% identical to PANC_PSEU5: Pantothenate synthetase (panC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 90% identity to psa:PST_3297)

MetaCyc: 54% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
phosphopantothenate biosynthesis I (4/4 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJS3 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Psest_0995 pantoate--beta-alanine ligase (Pseudomonas stutzeri RCH2)
MNIVKTIADLRAAVARARSEGKRIGFVPTMGNLHAGHIALVKKAGQRADFVVASIFVNPL
QFGPNEDLDSYPRTLAADQDKLFEAGCHLLFAPSVDEMYPHGQAQQTIVRVPGVSEGLCG
GSRPGHFDGVSTVVTKLFNMVLPDLAVFGQKDFQQLAVIRTMVRDLNMPVQILSEPIVRA
DDGLALSSRNGYLTADERATAPVLYRTLKELETAIRGGRRDYPALIAVGLSALQSAGLRP
DYLEIRNAIDLQPVSDASSEVVILVAAYLGKTRLLDNLLVDIRTSA