Protein Info for Psest_0993 in Pseudomonas stutzeri RCH2

Annotation: Glucose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00342: PGI
  • amino acids 55 to 545 (491 residues), 650.9 bits, E=6.1e-200

Best Hits

Swiss-Prot: 98% identical to G6PI_PSEU5: Glucose-6-phosphate isomerase (pgi) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01810, glucose-6-phosphate isomerase [EC: 5.3.1.9] (inferred from 98% identity to psa:PST_3299)

MetaCyc: 50% identical to glucose-6-phosphate isomerase (Homo sapiens)
Glucose-6-phosphate isomerase. [EC: 5.3.1.9]

Predicted SEED Role

"Glucose-6-phosphate isomerase (EC 5.3.1.9)" in subsystem Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.3.1.9)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• Bifidobacterium shunt (15/15 steps found)
• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• homolactic fermentation (11/12 steps found)
• colanic acid building blocks biosynthesis (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• heterolactic fermentation (15/18 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose biosynthesis II (6/8 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• gluconeogenesis III (8/12 steps found)
• sucrose degradation III (sucrose invertase) (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• D-sorbitol biosynthesis I (1/3 steps found)
• sucrose biosynthesis III (1/3 steps found)
• formaldehyde oxidation I (3/6 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• 1,5-anhydrofructose degradation (2/5 steps found)
• starch biosynthesis (5/10 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis III (2/6 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (9/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.9

Sequence Analysis Tools

See L0GIG3 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Psest_0993 Glucose-6-phosphate isomerase (Pseudomonas stutzeri RCH2)
MSYYQHPLDVTGLPSWKALEEHRLDMQNFSMREAFKADPTRFDDLSVSCSGLFLDYSKNL
ITPETRTLLVNLAREAGVEQAAHAMFEGERINASENRPVLHTALRRPMGESVMVDGKNIM
RDVHTALAQMTDIVTRIHNNLWRGFSDKTITDVVNIGIGGSFLGPQLVSEALLPFTQHGV
RTHYLANIDGSEFREVTAKLNVETTLFIISSKTFGTLETLKNAQAARTWYLGKGGTEEKL
YRHFIAVTSNKQAAVEFGIREKNIFPMWDWVGGRYSLWSAIGLPIALAIGMSNFKDLLSG
AYSMDQHFLSEPFESNMPVLLAMLGIWYHNFWGAQSYAFLPYDHYLRNFVKHLQQMDMES
NGKSVRQDGTPVSCTTGPVIWGGVGCNGQHAYHQLLHQGTPLIPADFIVPVVSHNPVADH
HEWLYANCLSQSQALMRGKTREEAEAELRAKGLDEAEVQRLAPHKVIPGNRPSNTVVMET
ISPGRLGALIALYEHKVFVQGVIWGINSFDQWGVELGKDLGKAVYNQMTRFDAAPAEDAS
TQGLIDFFRGRHRG