Protein Info for PGA1_c09680 in Phaeobacter inhibens DSM 17395

Annotation: celldivision protein FtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details TIGR01174: cell division protein FtsA" amino acids 25 to 408 (384 residues), 312.7 bits, see alignment E=1.8e-97 PF02491: SHS2_FTSA" amino acids 114 to 191 (78 residues), 69.6 bits, see alignment E=4.7e-23 PF06723: MreB_Mbl" amino acids 230 to 383 (154 residues), 42.5 bits, see alignment E=7.6e-15 PF14450: FtsA" amino acids 236 to 406 (171 residues), 101.9 bits, see alignment E=7.1e-33

Best Hits

KEGG orthology group: K03590, cell division protein FtsA (inferred from 88% identity to sit:TM1040_0688)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EV99 at UniProt or InterPro

Protein Sequence (444 amino acids)

>PGA1_c09680 celldivision protein FtsA (Phaeobacter inhibens DSM 17395)
MTDLYQSQRAMRQMRRQAMQRGVVAILDVGSSKIACLVLRFDGTGRLSEDNSIGSLAGQS
GFRVIGAATTRSRGVQFGEITAMQETERAIRTAVQAAQKMAEVRVDHVIACFSGANPRSY
GLDAQVDLEGQVVTENEIARVLAACEVPEYGAGREVLHAQPVNFALDNRSGLNDPRGQMG
QTLAADMHMLTVDALTVQNLVRCIQRCDLELAGIASSAYASGFAALVEDEQELGAACIDM
GGGSTSISVFMKKHMIYADAVRMGGDHITSDISMGLGVPTANAERIKTFHGGVHATGADD
REMIDIHADTGDWEHDRRTVSRAELIGIMRPRVEEILEEVRARLDAAGFDSLPSQQIVLT
GGSSQIMGLDGLASRVLGQQVRLGRPLRVHGLPQSATGPGFASAVGLSLFAAHPQDEWWD
FEMPVDRNASGTLKRAVKWFRDNW