Protein Info for PGA1_c09670 in Phaeobacter inhibens DSM 17395

Annotation: putative cell division protein FtsQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details PF03799: FtsQ_DivIB_C" amino acids 156 to 269 (114 residues), 51.2 bits, see alignment E=2.3e-17

Best Hits

Swiss-Prot: 53% identical to FTSQ_ROSLO: Cell division protein FtsQ (ftsQ) from Roseobacter litoralis (strain ATCC 49566 / DSM 6996 / JCM 21268 / NBRC 15278 / OCh 149)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 69% identity to sit:TM1040_0687)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DNM4 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PGA1_c09670 putative cell division protein FtsQ (Phaeobacter inhibens DSM 17395)
MSSLIDRFRTPREGRPDPAPSRLTYRIQRWMLTPGIRFGVRFGIPFCLVFVAGAAFMADD
ARRDRLQVMISDLRASIEERPEFMVNVMAIDGAGRSVAEDIREVVPIDFPISSFDLDLTQ
IRDEITGLDPVQTADVRIRPGGVLQVTVEERKPAVVWRSREGLALLDANGVHVAELGARN
MHPDLPLVAGRSADDAIVEALRLFAVAKPLGPRMRGLVRIGERRWDLVLDRGQRIMLPAE
NPVPALERVIAVSEVRDLLERDVAAVDMRLAARPTVRMTENAVEDWWRIRQLNAGGL