Protein Info for PGA1_c09660 in Phaeobacter inhibens DSM 17395

Annotation: D-alanine--D-alanine ligase Ddl

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR01205: D-alanine--D-alanine ligase" amino acids 10 to 302 (293 residues), 255.4 bits, see alignment E=3.3e-80 PF01820: Dala_Dala_lig_N" amino acids 58 to 90 (33 residues), 43.8 bits, see alignment 3.7e-15 PF07478: Dala_Dala_lig_C" amino acids 133 to 300 (168 residues), 117.2 bits, see alignment E=7.4e-38

Best Hits

Swiss-Prot: 77% identical to DDL_RUEST: D-alanine--D-alanine ligase (ddl) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 77% identity to sit:TM1040_0686)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXT3 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PGA1_c09660 D-alanine--D-alanine ligase Ddl (Phaeobacter inhibens DSM 17395)
MSKSSRTLPKVAVLMGGPSAEREVSLSTGRECATALRDEGYQVTELDAGPDLAARLQADR
PDVVFNALHGRWGEDGCVQGLLEWLGIPYTHSGVLASALAMDKQRAKSIYRAAGLPVVES
GIYSKAEVMAGHVMAPPYVVKPNNEGSSVGVYLVNEVANGPPQLSQDMPDEVMVESFAPG
RELTTTVLGDKPLTVTDILTDGWYDYDAKYKPGGSRHVLPADVPEEIFALCLDYAVKAHD
ALGCRGISRTDFRWDEARGAEGLILLETNTQPGMTPTSLTPEQAEHSGMTFGQLCSWLVE
DATCPR