Protein Info for PGA1_c00970 in Phaeobacter inhibens DSM 17395

Annotation: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase IspH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00216: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase" amino acids 8 to 288 (281 residues), 328.1 bits, see alignment E=2e-102 PF02401: LYTB" amino acids 9 to 286 (278 residues), 315.8 bits, see alignment E=1.1e-98

Best Hits

Swiss-Prot: 91% identical to ISPH_RUEST: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (ispH) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03527, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [EC: 1.17.1.2] (inferred from 91% identity to sit:TM1040_2569)

MetaCyc: 55% identical to 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (Escherichia coli K-12 substr. MG1655)
RXN-24043 [EC: 1.17.7.4]; 1.17.7.4 [EC: 1.17.7.4]

Predicted SEED Role

"4-hydroxy-3-methylbut-2-enyl diphosphate reductase (EC 1.17.1.2)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.17.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.2 or 1.17.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIB2 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PGA1_c00970 4-hydroxy-3-methylbut-2-enyl diphosphate reductase IspH (Phaeobacter inhibens DSM 17395)
MTKPPLTLYLAAPRGFCAGVDRAIKIVEMALEKWGAPVYVRHEIVHNKYVVDGLRDKGAV
FVEELDECPDDRPVIFSAHGVPKSIPAEADRRQMIYVDATCPLVSKVHIEAQRHAENGLQ
MIMIGHKGHPETIGTMGQLPDGEVLLVETPDDVATVAVRDPDNLAYVTQTTLSVDDTKDI
VAALQSRFPNIVGPHKEDICYATTNRQEAVKEVAPKADALLVVGAPNSSNSRRLVEVGAK
AGCQYAQLVQRAENIDWRALEGISSVAITAGASAPELLVNEVIDAFKERFEVTVELVETA
IERVEFKVPRVLREPA