Protein Info for Psest_0979 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02576: RimP_N" amino acids 11 to 83 (73 residues), 101.5 bits, see alignment E=2.7e-33 PF17384: DUF150_C" amino acids 86 to 151 (66 residues), 66.1 bits, see alignment E=2.7e-22

Best Hits

Swiss-Prot: 99% identical to RIMP_PSEU5: Ribosome maturation factor RimP (rimP) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 99% identity to psa:PST_3312)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJQ9 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psest_0979 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MSSKLEQLQALLAPVVEALGYQCWGIEFISQGRHSLLRVYIDHADGILIDDCEKVSRQLS
GVLDVEDPISVDYTLEVSSPGMDRPLFTIEQYTAHVGDQVKIKLRSPFEGRRNFQGLLRG
VEEQDVVVLVDDHEYLLPIDMIDKANIIPRFD