Protein Info for PGA1_c09650 in Phaeobacter inhibens DSM 17395

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase MurB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 21 to 299 (279 residues), 163.6 bits, see alignment E=3.1e-52 PF01565: FAD_binding_4" amino acids 29 to 156 (128 residues), 65.4 bits, see alignment E=4.7e-22 PF02873: MurB_C" amino acids 192 to 300 (109 residues), 104.5 bits, see alignment E=2.9e-34

Best Hits

Swiss-Prot: 80% identical to MURB_RUEPO: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 80% identity to sil:SPO1200)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.158

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYZ6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PGA1_c09650 UDP-N-acetylenolpyruvoylglucosamine reductase MurB (Phaeobacter inhibens DSM 17395)
MNIDGLRGKLHPNRDLSGLTWLQVGGPADYLFQPVDIEDLSHMLRSLDPSVPVFPMGVGS
NLIVRDGGLRALVIRLGRGFNTIEIADDTVVAGAAALDGHVARKAADAGIDLTFLRTIPG
SIGGAVRMNAGCYGSYMADVFQSATVVLRSGEVVTLRGDDLKFAYRQSDLPEGAVLVSAV
LRGPKGDPEALHARMEEQLAKRDATQPTKDRSAGSTFRNPAGFSSTGQADDVHDLKAWKV
IDDAGMRGARRGAAQMSEKHSNFLINTGGASAADLEGLGEDVRKKVYANSGITLEWEIMR
VGDPLSK