Protein Info for PGA1_c09600 in Phaeobacter inhibens DSM 17395

Annotation: cell division protein ftsW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 177 to 193 (17 residues), see Phobius details amino acids 204 to 234 (31 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details TIGR02614: cell division protein FtsW" amino acids 45 to 392 (348 residues), 350.5 bits, see alignment E=5.4e-109 PF01098: FTSW_RODA_SPOVE" amino acids 49 to 392 (344 residues), 253.3 bits, see alignment E=1.8e-79

Best Hits

Swiss-Prot: 42% identical to FTSW_CAUVN: Probable peptidoglycan glycosyltransferase FtsW (ftsW) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03588, cell division protein FtsW (inferred from 87% identity to sit:TM1040_0681)

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYY9 at UniProt or InterPro

Protein Sequence (422 amino acids)

>PGA1_c09600 cell division protein ftsW (Phaeobacter inhibens DSM 17395)
MPNDPENGTDHEADSGGLPMTEMVYGALPVQAGEPILPKWWRTLDKWTMSCVLMLFVIGL
LLGLAASVPLAERNGFDNFHYVERQAVFGITALVAMVITSMMSPTLVRRLAVIGFICAFV
ALALLPVFGTDFGKGATRWYSLGFASLQPSEFLKPGFIVVAAWMIAASQQINGPPGTLMS
FGLCLTVVLMLVMQPDFGQACLVLFGWGVMYFVAGAPMLLLVIMAAVVVMGGVVAYSSSE
HFARRIDGFLNPEIDPTTQMGYATNAIREGGLFGVGVGEGEVKWSLPDAHTDFIIAVAAE
EYGLVLVVILILLYTAVVARTLFRLMRERDTFIRLAGTGLVCTFGVQAMINMGVAVRLLP
AKGMTLPFVSYGGSSLIAGGIAVGMLLAFSRSRPQGEIADFLRGHGRGHGHQNGPARGYG
RG