Protein Info for Psest_0963 in Pseudomonas stutzeri RCH2
Annotation: Molecular chaperone GrpE (heat shock protein)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to GRPE_PSEU5: Protein GrpE (grpE) from Pseudomonas stutzeri (strain A1501)
KEGG orthology group: K03687, molecular chaperone GrpE (inferred from 98% identity to psa:PST_3328)Predicted SEED Role
"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GHS9 at UniProt or InterPro
Protein Sequence (189 amino acids)
>Psest_0963 Molecular chaperone GrpE (heat shock protein) (Pseudomonas stutzeri RCH2) MADEQNLDNQNPETPEHSEADVAEDLAARVQSLEEQLAAAQDQSLRVAAELQNIRRRAEQ DVEKAHKFALEKFAGDLLAVADSLERGLELSSPDDDAVKPMREGVELTLKLLLDTLARHQ LEQLDPHGEPFNPEHHQAMAMEESTHVEPGSVLKVFQKGYLLNGRLLRPAMVVVSKAPAD APPSIDEKA