Protein Info for PGA1_c09470 in Phaeobacter inhibens DSM 17395

Annotation: putative ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF01883: FeS_assembly_P" amino acids 6 to 75 (70 residues), 60 bits, see alignment E=6.8e-20 PF10609: ParA" amino acids 110 to 350 (241 residues), 323.3 bits, see alignment E=2.9e-100 PF13614: AAA_31" amino acids 112 to 150 (39 residues), 33.7 bits, see alignment 1e-11 PF09140: MipZ" amino acids 113 to 160 (48 residues), 28.9 bits, see alignment 2.1e-10 PF01656: CbiA" amino acids 115 to 328 (214 residues), 50.2 bits, see alignment E=7.5e-17 PF02374: ArsA_ATPase" amino acids 118 to 149 (32 residues), 25.6 bits, see alignment (E = 2.1e-09)

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 82% identity to sit:TM1040_2022)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DNJ8 at UniProt or InterPro

Protein Sequence (356 amino acids)

>PGA1_c09470 putative ATP-binding protein (Phaeobacter inhibens DSM 17395)
MAPTYDEIRDALARLQLPDGGTLVSRDMLRALMVDGGRVSFVIEAPNPQIAAQMEPLRRA
AEATVLALPGVESVSAALTAHADAVAKPAPTLKLGGHPKPQQGPMKPSGVKRILAIGSGK
GGVGKSTVSANLAVALTRQGRKVGLLDADIYGPSQPRMMGASGRPASPDGKIIEPLHAHG
VTLMSIGFMVDEAKAVVWRGPMLMGALQQMLGQVNWGELDVLIVDLPPGTGDVQLTLCTK
AELSGAIVVSTPQDVALLDARKALDMFNTLKTPVLGLIENMSFFTCPDCGGEHHIFGHGG
VAAEAERLGVPLLGALPIDLDTRLAGDSGTPIAAGDSAMAQAYAQMAEGLIRGGMA