Protein Info for HP15_907 in Marinobacter adhaerens HP15

Annotation: acyl-CoA dehydrogenase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF02771: Acyl-CoA_dh_N" amino acids 6 to 117 (112 residues), 125 bits, see alignment E=4e-40 PF02770: Acyl-CoA_dh_M" amino acids 122 to 217 (96 residues), 87.2 bits, see alignment E=1.3e-28 PF00441: Acyl-CoA_dh_1" amino acids 229 to 379 (151 residues), 166.8 bits, see alignment E=7.8e-53 PF08028: Acyl-CoA_dh_2" amino acids 246 to 367 (122 residues), 78.8 bits, see alignment E=9.8e-26

Best Hits

Swiss-Prot: 54% identical to ACAD8_HUMAN: Isobutyryl-CoA dehydrogenase, mitochondrial (ACAD8) from Homo sapiens

KEGG orthology group: K00248, butyryl-CoA dehydrogenase [EC: 1.3.8.1] (inferred from 91% identity to maq:Maqu_2132)

MetaCyc: 42% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.1, 1.3.99.2

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PEW6 at UniProt or InterPro

Protein Sequence (388 amino acids)

>HP15_907 acyl-CoA dehydrogenase domain protein (Marinobacter adhaerens HP15)
MDFNLTEDQLAFREAARAFAEKSMAPHAAKWDNEHIFPVDMMKEAGEMGFMGMYTPEALG
GMGLSRLDTSVIVEELAAACPSTAAFITIHNMATWMVASFASDDLKQEIVPKLASGEWLA
SYCLTEPGAGSDAASLRTKAVRDGDSYVINGSKVFISGAGATDILVLMARTGAPDSGYKG
ISTFVIPADADGISYGKNEEKMGWHSQPTRMISLENVRIPASNRVGDEGDGFAIAMKGLD
GGRLNIATCSLGGAQAALLRARNYMHEREQFGKPLAAFQALQFKLADMATNLVAARQMVR
LGAFKLDNADPEATLHCAMAKRFATDACFEVVNEALQLHGGYGYIREYPLERYLRDLRVH
QILEGTNEIMRLIVARRLLDDGVAEAIQ