Protein Info for Psest_0955 in Pseudomonas stutzeri RCH2

Updated annotation (from data): D,L-lactate:H+ symporter
Rationale: Important for utilization of L,-lactate, D-lactate, D,L-lactate. Also important in many nitrogen source experiments with D,L-lactate as the carbn source.
Original annotation: L-lactate transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 322 to 339 (18 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 449 to 467 (19 residues), see Phobius details amino acids 479 to 500 (22 residues), see Phobius details amino acids 506 to 525 (20 residues), see Phobius details amino acids 537 to 556 (20 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 5 to 553 (549 residues), 342.2 bits, see alignment E=3.1e-106 PF02652: Lactate_perm" amino acids 7 to 550 (544 residues), 350.1 bits, see alignment E=1.2e-108

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 96% identity to psa:PST_3336)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFN1 at UniProt or InterPro

Protein Sequence (564 amino acids)

>Psest_0955 D,L-lactate:H+ symporter (Pseudomonas stutzeri RCH2)
MSNGLLALFAFTPILLAAIMLIGLRWPASRAMPLVFLFTAAIGLFVWDMSVNRIIASTLQ
GLVITLGLLWIIFGAILLLNTLKHSGGITAIRAGFTTISPDRRIQAIIIAWLFGCFIEGA
SGFGTPAAIAAPLLVAVGFPAMAAVLLGMLVQSTPVSFGAVGTPIVVGINSGLDTATIGA
QLVAQGSSWNAYLQQITSSVAITHAIVGTVMPLVMVLMLTRFFGKEKSWKAGFEVLPFAI
FAGLAFTLPYAATGIFLGPEFPSLLGGLVGLAIVTTAARFKFLTPKTTWDFADAKEWPAE
WLGTIEMKLDEMAARPMSAFRAWLPYVLVGAILVISRVFPQVTAALKSVSIAFANILGET
GINAGIEPLYLPGGILVMVVLITFFLHGMRVSELKAAVKESSGVLLSAGFVLLFTVPMVR
ILINSGVNGAELASMPIVMARYVADSVGSIYPLLAPAVGALGAFLAGSNTVSNMMFSQFQ
FGVAQSLGISGAMVVATQAVGAAAGNMVAIHNVVAASATVGLLGREGSTLRKTIWPTLYY
VLFTGVIGLIAIYVLGVTDPLVGV