Protein Info for Psest_0953 in Pseudomonas stutzeri RCH2

Annotation: iron-sulfur cluster-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 TIGR00273: iron-sulfur cluster-binding protein" amino acids 28 to 403 (376 residues), 484 bits, see alignment E=2e-149 PF02589: LUD_dom" amino acids 80 to 304 (225 residues), 168.5 bits, see alignment E=3.5e-53 PF13183: Fer4_8" amino acids 321 to 387 (67 residues), 48.5 bits, see alignment E=2.7e-16 PF11870: LutB_C" amino acids 395 to 481 (87 residues), 98 bits, see alignment E=8.4e-32

Best Hits

Swiss-Prot: 42% identical to LUTB_BACVZ: Lactate utilization protein B (lutB) from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)

KEGG orthology group: None (inferred from 96% identity to psa:PST_3338)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHS2 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Psest_0953 iron-sulfur cluster-binding protein (Pseudomonas stutzeri RCH2)
MNAEQRIPAIQIENAGDPDFRARARKSLKDDQLRRNFRTAMDSLMTKRAVAFSDADERER
LREMGNRIRARALSKLPELLERLETNLTRNGVNVHWAETVEEANNIVLEIARAHEARQVI
KGKSMVSEEMEMNHFLEGHGIECLESDMGEYIVQLDHEKPSHIIMPAIHKNAGQVASLFH
EKLGVEYTKDVDQLIQIGRRTLRQKFFEADIGVSGVNFAVAETGTLLLVENEGNGRMSTG
VPPVHIAVTGIEKVVENLRDVVPLLSLLTRSALGQPITTYVNMISSPRKADELDGPQEVH
LILLDNGRSQAFADSELRQTLNCIRCGACMNHCPVYTRVGGHTYGEVYPGPIGKIITPHM
VGLDKVPDHPSASSLCGACGEVCPVKIPIPSILRRLREENIKAPDDPHKVMRGQGSKYSK
KERLMWAGWRLLNTNPTLYRVFGFFATRLRGLTPSNIGPWTQNHSAPKPAARSLHELARE
HLEGKR