Protein Info for PGA1_c09380 in Phaeobacter inhibens DSM 17395

Annotation: putative type 2 restriction enzyme naeI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF09126: NaeI" amino acids 42 to 283 (242 residues), 203.3 bits, see alignment E=2.5e-64

Best Hits

Predicted SEED Role

"Cys-tRNA(Pro) deacylase YbaK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EKC6 at UniProt or InterPro

Protein Sequence (303 amino acids)

>PGA1_c09380 putative type 2 restriction enzyme naeI (Phaeobacter inhibens DSM 17395)
MKQKLPPSQVSPGHADHALLAALAQDITTRAGGLMELTRSVPAMLRDCIDDVILTAKTGR
RAYEDLEKTEKTYIGTRVEIELRALLRLPKGRLDTEILGHDVDIKHTMGSNWMIPTEAVD
QPCILVAADEPRARCYLGLIVARRDYLTAGQNKDAKRSISAQGFENILWLLCDQPYPANF
WRLLPEATVEDIFAGDSGNARMATLFRTVQRQPIPRDVVEAVAAQKDFMRRIRSDGGHGT
RDLLARDGIVILEGRKDAQLIRALDLPHCSASEFISAQLTTLAEARLAASAGHAGCEDFF
SQP