Protein Info for Psest_0945 in Pseudomonas stutzeri RCH2

Annotation: chromate transporter, chromate ion transporter (CHR) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 156 to 187 (32 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 339 to 363 (25 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details amino acids 435 to 452 (18 residues), see Phobius details PF02417: Chromate_transp" amino acids 23 to 187 (165 residues), 156.9 bits, see alignment E=2.4e-50 amino acids 262 to 447 (186 residues), 124.1 bits, see alignment E=2.8e-40 TIGR00937: chromate efflux transporter" amino acids 29 to 446 (418 residues), 231.3 bits, see alignment E=1.4e-72

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 97% identity to pmy:Pmen_2247)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJN7 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Psest_0945 chromate transporter, chromate ion transporter (CHR) family (Pseudomonas stutzeri RCH2)
MSETAMQATEQDQDRVEKIGLLEAFLFWLKLGFISFGGPAGQISIMHQELVERRRWISER
RFLHALNYCMLLPGPEAQQLATYIGWLMHRTWGGVIAGVLFVLPSLFILIALSWVYIAFG
EVPVVAGLFYGIKPAVTAIVVQAAHRIGSRALKNNWLWAIAAASFVAIFALNIPFPLIVL
GAAMIGYLGGRYAPDKFSVGGGHGASKQSYGPALIDDDTPPPAHARFRWSRLALLVAVGA
VLWALPMGLLTALYGWEGTLTQMGWFFTKAALLTFGGAYAVLPYVYQGAVGHYGWLTPTQ
MIDGLALGETTPGPLIMVVAFVGFVGAYVHQVFGPEQAFLAGAVAASLVTWFTFLPSFLF
ILAGGPLVESTHNELKFTAPLTGITAAVVGVILNLALFFGYHVLWPEGFAGSFDWLSALI
AVGAAVALFRFKRGVIQVLVGCALVGLAIHLLR