Protein Info for Psest_0942 in Pseudomonas stutzeri RCH2

Annotation: TraX protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 8 to 26 (19 residues), see Phobius details amino acids 31 to 53 (23 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 163 (48 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details PF05857: TraX" amino acids 5 to 229 (225 residues), 149.3 bits, see alignment E=7.6e-48

Best Hits

KEGG orthology group: None (inferred from 93% identity to pmy:Pmen_2245)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHR5 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Psest_0942 TraX protein. (Pseudomonas stutzeri RCH2)
MRSTSLDLVKWLAMLTMVIDHLRYLWPEETAWLFVVGRFAFPLFCVGIAANVSRSRPGDL
YSDNNFRYLSWLLAFSLISELPYRALSEMSNTLNVMPTLMLGLIVAWSVHHSDRAGLMLG
LFTLTVATVLHDRLMYGAFGVLLPATMVLAVQRPGVTWLIPAVISVLANSRDGWIGAGPF
GTWWAMATTFAAPLVGLWLLRQKITQHIWPVGRWGYYFYPGHLAVLALFRAAL