Protein Info for PGA1_c09240 in Phaeobacter inhibens DSM 17395

Annotation: imidazole glycerol phosphate synthase subunit HisF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 251 (251 residues), 346.5 bits, E=4e-108
• PF00977: His_biosynth
  • amino acids 5 to 235 (231 residues), 285.3 bits, E=4.9e-89

Best Hits

Swiss-Prot: 94% identical to HIS6_RUEST: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 94% identity to sit:TM1040_2041)

MetaCyc: 52% identical to imidazole-glycerol-phosphate synthase cycloligase subunit (Thermotoga maritima)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Sequence Analysis Tools

See I7DNH5 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PGA1_c09240 imidazole glycerol phosphate synthase subunit HisF (Phaeobacter inhibens DSM 17395)
MLKTRIIPCLDVADGRVVKGVNFVGLRDAGDPVEAAKAYDAAGADEICFLDIHATHENRG
TMFDMVRRTAEQCFVPLTVGGGVRTKEDVRALLLAGADKVSFNSAAVANPDVIREAADQF
GSQCTVCAIDAKTVAPGKWEIFTHGGRRETGIDAVEFARLVVAKGAGEILLTSMDRDGTK
SGFNLPLTRAISDAVDVPVIASGGVGTLDHLVEGVTEGGASAVLAASIFHFGEFTVQEAK
QHMAAAGIPMRLT