Protein Info for Psest_0932 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00440: TetR_N" amino acids 28 to 69 (42 residues), 43.2 bits, see alignment 4e-15 PF16925: TetR_C_13" amino acids 96 to 201 (106 residues), 94.5 bits, see alignment E=8.2e-31 PF21993: TetR_C_13_2" amino acids 96 to 201 (106 residues), 51.7 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 50% identical to ACUR_RHOS4: Transcriptional regulator AcuR (acuR) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 65% identity to avn:Avin_25370)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFL3 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Psest_0932 Transcriptional regulator (Pseudomonas stutzeri RCH2)
MTSAKPVARRGRPPKVPREREDTHDALLRCGMEVLSEQGFAATGIDSVLKRINVPKGSFY
HYFNSKEAFGQAVLDRYASRFARKLDLLLLNEADPPLQRIRNFVEDAKEGMAKYEFRRGC
LVGNLGQEIMALPESFRLALEHTLIDWQERLACCLREAASQGQIDSDSDCDSLAAFFWIG
WEGAVLRSKLSRDVRPLEIFSEGFFAAIGR