Protein Info for PGA1_c09220 in Phaeobacter inhibens DSM 17395

Annotation: Predicted CoA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02629: CoA_binding
  • amino acids 15 to 104 (90 residues), 23.8 bits, E=6.1e-09
• PF13380: CoA_binding_2
  • amino acids 17 to 135 (119 residues), 136.7 bits, E=5.1e-44

Best Hits

Swiss-Prot: 50% identical to YCCU_ECOLI: Uncharacterized protein YccU (yccU) from Escherichia coli (strain K12)

KEGG orthology group: K06929, (no description) (inferred from 81% identity to sil:SPO1153)

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (3/5 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

See I7DYU9 at UniProt or InterPro

Protein Sequence (156 amino acids)

>PGA1_c09220 Predicted CoA-binding protein (Phaeobacter inhibens DSM 17395)
MPDYTDQHLKDVLTRNKTIAVVGVSTNPVRPSYYVARYLGLKGYRVLPVNPGYAGKSLFG
QTIHASLSDIQEPVDMVDIFRRSEAVPPIVEEALEVCKGLQTIWMQIGVEHAEAAAKAEA
AGLTVIQNRCPKIEYQRLFGELRMGGFATGIISSKL