Protein Info for PGA1_c09200 in Phaeobacter inhibens DSM 17395

Annotation: putative 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR00186: RNA methyltransferase, TrmH family, group 3" amino acids 24 to 254 (231 residues), 188.8 bits, see alignment E=5.7e-60 PF08032: SpoU_sub_bind" amino acids 24 to 95 (72 residues), 30.3 bits, see alignment E=4.4e-11 PF00588: SpoU_methylase" amino acids 111 to 253 (143 residues), 116.6 bits, see alignment E=1e-37

Best Hits

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 84% identity to sit:TM1040_2049)

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EV65 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PGA1_c09200 putative 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (Phaeobacter inhibens DSM 17395)
MSKKPKWVVEKEQSKKAASAETVWLFGLHAVRDALLNPKREKLRLMVTQNAEAKLADAIA
QSGVEAEVIDPRKFNPPIDKQSVHQGAALEVKPLNWGGLDENCIGAEVPRVLLLDRVTDP
HNVGAILRSAEVLGASAVIGTRHNSAPETGALAKTASGALERQPYLRMRNLADTIVELQR
MGFLVLGLDGEAEQTIEAVLDGRKGDPVALVLGAEGPGLRQKTKETVDHLVKIDAAGGFG
SLNVSNAAAIALYASLPR