Protein Info for Psest_0929 in Pseudomonas stutzeri RCH2

Annotation: ABC-type proline/glycine betaine transport systems, periplasmic components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 56% identity to cvi:CV_1629)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1) / Osmotic adaptation" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJF6 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Psest_0929 ABC-type proline/glycine betaine transport systems, periplasmic components (Pseudomonas stutzeri RCH2)
MKPIIRLGYIDLSFHAASAALVQRVLERHDYEVQVSAAPHEDMFRRYGAGAVDMLASAWL
PASHGDYLAPYAAQTRTLGVLYRPYCIWGVPDYVPVDAVQSVADLLRPEVATRMTRLIQG
INPGAGISRFSRAIVQQYGLDRLGYHFENGTQADCFVRYEQAHARREWCVVPLWHPQFLH
HSHRIRPLDEPLGLLGGQDDATLIVSEPFARDMPAALLEELNRLSPGNEVISELDHSICR
DGMSALQAADAWLARSVAL