Protein Info for PGA1_c00920 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): putative transporter, required for glycine utilization
Rationale: PFam PF03458.9 (UPF0126). conserved specific phenotype of UPF0126
Original annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 51 (22 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details PF03458: Gly_transporter" amino acids 6 to 80 (75 residues), 77.1 bits, see alignment E=3.8e-26 amino acids 92 to 164 (73 residues), 59.6 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 35% identical to YADS_ECOLI: UPF0126 inner membrane protein YadS (yadS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 80% identity to sit:TM1040_2574)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIA9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>PGA1_c00920 putative transporter, required for glycine utilization (Phaeobacter inhibens DSM 17395)
MTILTLLDYASVLVFAASGALVASRAQLDIVGFAFVACLTAVGGGTVRDLLLDRHPVFWI
GDSTNILLAAAAAVLVFFTAHLVESRLRWIVWLDSFALAVAVSAGTGAAILTGQPPVIVV
LMGMATGTLGGLMRDVVCNEVPLVLKQGELYISCAMAGAITAVVSIAFGLPNRWALVACA
VVCWVLRAGSITFGWHLPVYRSRPPRS