Protein Info for Psest_0009 in Pseudomonas stutzeri RCH2

Annotation: histidinol-phosphate phosphatase family domain/HAD-superfamily hydrolase, subfamily IIIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR01662: HAD hydrolase, family IIIA" amino acids 14 to 153 (140 residues), 103 bits, see alignment E=1.5e-33 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 15 to 157 (143 residues), 136.8 bits, see alignment E=5.3e-44 PF00702: Hydrolase" amino acids 24 to 147 (124 residues), 29.1 bits, see alignment E=1.9e-10 PF08645: PNK3P" amino acids 32 to 128 (97 residues), 26.1 bits, see alignment E=9.8e-10 PF13242: Hydrolase_like" amino acids 111 to 182 (72 residues), 39 bits, see alignment E=9.6e-14

Best Hits

Swiss-Prot: 65% identical to GMHBB_PSEAE: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 97% identity to psa:PST_0008)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-, 3.1.3.15

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFT4 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Psest_0009 histidinol-phosphate phosphatase family domain/HAD-superfamily hydrolase, subfamily IIIA (Pseudomonas stutzeri RCH2)
MALPIFPHLAKPVKLIVLDRDGVINEDSDEYVKSLAEWIPIPGSLEAIARLCKAGWTVAV
ATNQSGVARGKFDLSTLGDMHFKMQQLVMEQGGRIDLIVHCPHGPDDGCNCRKPKPGMFR
SIAEHFGLADLKGVPVVGDSHRDLHAGMLLGGVPYLVRTGKGLRTLEGTLPPGTQVFDDL
AAVVDHLLESSR