Protein Info for Psest_0009 in Pseudomonas stutzeri RCH2

Annotation: histidinol-phosphate phosphatase family domain/HAD-superfamily hydrolase, subfamily IIIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01662: HAD hydrolase, family IIIA
  • amino acids 14 to 153 (140 residues), 103 bits, E=1.5e-33
• TIGR01656: histidinol-phosphate phosphatase domain
  • amino acids 15 to 157 (143 residues), 136.8 bits, E=5.3e-44
• PF00702: Hydrolase
  • amino acids 24 to 147 (124 residues), 29.1 bits, E=1.9e-10
• PF08645: PNK3P
  • amino acids 32 to 128 (97 residues), 26.1 bits, E=9.8e-10
• PF13242: Hydrolase_like
  • amino acids 111 to 182 (72 residues), 39.8 bits, E=5.3e-14

Best Hits

Swiss-Prot: 65% identical to GMHBB_PSEAE: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 97% identity to psa:PST_0008)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Ether lipid metabolism
• Fructose and mannose metabolism
• Glycerophospholipid metabolism
• Histidine metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Retinol metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-, 3.1.3.15

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

See L0GFT4 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Psest_0009 histidinol-phosphate phosphatase family domain/HAD-superfamily hydrolase, subfamily IIIA (Pseudomonas stutzeri RCH2)
MALPIFPHLAKPVKLIVLDRDGVINEDSDEYVKSLAEWIPIPGSLEAIARLCKAGWTVAV
ATNQSGVARGKFDLSTLGDMHFKMQQLVMEQGGRIDLIVHCPHGPDDGCNCRKPKPGMFR
SIAEHFGLADLKGVPVVGDSHRDLHAGMLLGGVPYLVRTGKGLRTLEGTLPPGTQVFDDL
AAVVDHLLESSR