Protein Info for PGA1_c09070 in Phaeobacter inhibens DSM 17395

Annotation: thiazole biosynthesis protein ThiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF05690: ThiG" amino acids 3 to 247 (245 residues), 338.4 bits, see alignment E=1.2e-105

Best Hits

Swiss-Prot: 69% identical to THIG_BRUA2: Thiazole synthase (thiG) from Brucella abortus (strain 2308)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 70% identity to sno:Snov_2601)

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DNG1 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PGA1_c09070 thiazole biosynthesis protein ThiG (Phaeobacter inhibens DSM 17395)
MQLYGQDITSRLLLGTAQYPSPSVLNAAIKSSASEIITVSLRRETAEGTGAGFWDQLRTL
NCRILPNTAGCHSLQEAVTTAHMARELFDTPWIKLEVIGHSDTLQPDVFALVEAARVLSD
DGFQVFPYTTDDLVVGEKLLEAGCEVLMPWGAPIGSGQGLRNPDALRAMRAHFPDVPLIV
DAGIGRPSDATQAMELGMDAVLLNTAVAKAGDPAGMARAIALAIEAGRGGYLADPMERRD
MAVPSTPVLGLAALS