Protein Info for PGA1_c09020 in Phaeobacter inhibens DSM 17395

Annotation: putative methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details PF08269: dCache_2" amino acids 42 to 191 (150 residues), 100.1 bits, see alignment E=3.3e-32 PF17200: sCache_2" amino acids 42 to 189 (148 residues), 130.1 bits, see alignment E=1.7e-41 PF17201: Cache_3-Cache_2" amino acids 72 to 188 (117 residues), 39.5 bits, see alignment E=1e-13 PF00672: HAMP" amino acids 210 to 262 (53 residues), 37.9 bits, see alignment 4.4e-13 PF00015: MCPsignal" amino acids 389 to 543 (155 residues), 181.3 bits, see alignment E=3.7e-57

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 45% identity to sit:TM1040_0476)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EV55 at UniProt or InterPro

Protein Sequence (644 amino acids)

>PGA1_c09020 putative methyl-accepting chemotaxis protein (Phaeobacter inhibens DSM 17395)
MPSIFFRLPIRIYAVVAMALALSVLLTVLLLSRAVDNAYAMRDRELHNIIDTSISLLADL
EARVQSGDLTADEARAQGREVIEKIRFETSGYLFAFDQNLVVRAHPMVPDWVGTDRSGFE
DVKGMKVFQELGKVAASDGAGSVRYWFQKPGQTTPEQKIGYVQAFEPWGWIIGTGSYVSD
IQADLAQMRIESMITLGVSLVLLMIASTVLLRSVTGPINGLKARMASMAEGETHADVPYT
QARSEIGEMARTLEAFREKLEQQEEMKGHQQARDAERADVVQVISSRLATLSQGDLTVRI
NENLPEDYAQLQRDFNRTAETLGSTVTQVIDTAESIRSGANEISQASDDLSNRTESQAAT
LEETAAALDEMTASVKSAAEGARSVESIMQEAKQEAETSGEVVQSAVSAMTEIEQSSSHI
SQIISVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVASEVRALAQRSSDAAMEIKTLI
GDSTKQVERGVDLVGKTGDALQGIVERVSHISQLVSGIATGASEQSTGLHEINTGVTQLD
QVTQQNAAMVEEATAAGHMLNADASKLAELVAHFRVAAGDGQAPARKPAAATAPTRRAVA
TQEAAPAAPSAHGDDWDLEAVTPQPAPAAASTSGNAAKDIWQDF