Protein Info for PGA1_c08940 in Phaeobacter inhibens DSM 17395

Annotation: N utilization substance protein B homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 TIGR01951: transcription antitermination factor NusB" amino acids 20 to 157 (138 residues), 117 bits, see alignment E=3.4e-38 PF01029: NusB" amino acids 22 to 156 (135 residues), 96.8 bits, see alignment E=6.9e-32

Best Hits

Swiss-Prot: 45% identical to NUSB_MARMM: Transcription antitermination protein NusB (nusB) from Maricaulis maris (strain MCS10)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 77% identity to sit:TM1040_2127)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXL6 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PGA1_c08940 N utilization substance protein B homolog (Phaeobacter inhibens DSM 17395)
MTTSDSQGAARKGSDKHKMKSASRLYAVQALFQMEHSNLTFDKVIVEFEDHRFGAVYDGD
EMAEGDTKSFRKLIEGAVNEQAKIDQMTDRALVAKWPIARIDPTLRALFRAAGAEFLAGK
TPPKVVINEFVDIARAFFPEGKEPKFVNAVLDHMAREAAPEAF