Protein Info for Psest_0902 in Pseudomonas stutzeri RCH2

Annotation: Predicted transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 47% identical to YBZH_BACSU: Uncharacterized HTH-type transcriptional regulator YbzH (ybzH) from Bacillus subtilis (strain 168)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 99% identity to ppu:PP_2484)

Predicted SEED Role

"Regulatory protein, ArsR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHN2 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Psest_0902 Predicted transcriptional regulators (Pseudomonas stutzeri RCH2)
MTIDVNEALKALANPMRLAILNWLKDPRTVFPEQEVDPETVGVCVSIIQERTGLSQSTTS
LYLAALQRAQLVTSQRIGPWTYYKRHDENIDAFFKALQERI