Protein Info for Psest_0897 in Pseudomonas stutzeri RCH2

Annotation: VRR-NUC domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 PF21315: FAN1_HTH" amino acids 9 to 89 (81 residues), 120.9 bits, see alignment E=2.6e-39 PF18081: FANC_SAP" amino acids 94 to 144 (51 residues), 43.1 bits, see alignment 6e-15 PF08774: VRR_NUC" amino acids 433 to 543 (111 residues), 123 bits, see alignment E=1e-39

Best Hits

KEGG orthology group: None (inferred from 58% identity to pmy:Pmen_4110)

Predicted SEED Role

"Hypothetical protein, restriction endonuclease-like VRR-NUC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFI6 at UniProt or InterPro

Protein Sequence (546 amino acids)

>Psest_0897 VRR-NUC domain. (Pseudomonas stutzeri RCH2)
MSVSLAPELYYLSNFRTALAWVAERYADLLADEERAFLDTFNTLPWPSQALLVRMISRKG
CHFRLSKLVYPEIGDCLAAADPLLEQGWITEQALLTADEIAELLRKDEVLTHMPLTDRRA
AQKKAELLEQLRAMELPAQTFTDWCPMLDDQLLSLMVGELCDRLRLMFFGNLAQDWSEFV
LTDLGIYRYESVDIGPESRGFQCRQDLEDYLHLRQLRVSVEQGADLADIVPPLLAFSSSN
PYLCSRQSCLLFQIAQQLERSGELEQALLLYQQSAHGEARWRQIRVLEQLGRDAEAYDQA
LAFSQTPGSDEESQRLERALTRLQRKLGLQMVKKPKAASETRIDLVLPAPTHGSVEIAVR
DHLQQDDAPVHYVENTLLCSLFGLLCWEAIFAPLPGSFFHPFHSGPVDLHSPDFYARRQH
LFKRCLLQLEQPDYRQLIKARYQEKFGLQSPFVFWGMLDEARLELALQCIPAAHLHACFT
RLLRDLKANRAGMPDLIQFYPQEHRYRMIEVKGPGDRLQDNQKRWLSFAAEHGIAVVVCY
VRWAEA