Protein Info for PGA1_c08880 in Phaeobacter inhibens DSM 17395

Annotation: capsule polysaccharide export protein KpsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 PF05159: Capsule_synth" amino acids 52 to 152 (101 residues), 34.2 bits, see alignment E=9.8e-13 amino acids 161 to 305 (145 residues), 94.9 bits, see alignment E=3.2e-31 amino acids 398 to 456 (59 residues), 42.1 bits, see alignment 3.9e-15 amino acids 483 to 628 (146 residues), 99.3 bits, see alignment E=1.5e-32

Best Hits

KEGG orthology group: K07266, capsular polysaccharide export protein (inferred from 66% identity to sit:TM1040_2134)

Predicted SEED Role

"Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYS1 at UniProt or InterPro

Protein Sequence (676 amino acids)

>PGA1_c08880 capsule polysaccharide export protein KpsC (Phaeobacter inhibens DSM 17395)
MTGHHPTTKAGGARSRLFYYNAGFLRQKRLRRILSLAGYDLRLGKPTADDLVAVWGNADT
AHRGHAVAEAQGCGLLRVEDAFLRSIHPGRAGEPPLGLLLDRSGLHFDPATPSDLEQLLA
SHPLDDSALMRRARRAIARLQDAHLSKYNAYSPQAPVPDPGYVLVIDQARGDASVRASTP
FEGTDHARFQEMLYYAQDEHPGARIIIKSHPEDRAGHRPGYYSAADAQGRVEILNTPVSP
WALLEGAIAVYTVSSQMGFEAILCGHKPRIFGQPFYAGWGLSEDEFPITRRQRSLTRAQL
FAAAMILYPTWYSPHHDRLCELEEVIGALEAETRAWQQDRAGWIASGMRLWKRHPLQTFF
GRYRRLRFSNSPKTAKASGRNWMIWAGRTSTGQSPGAHRVEDGFLRSRGLGADLIPPLSL
VVDRQGIYYDPHQPSDLEDLIAARATLTPEQQQRAETLTQRLVQDSLSKYNLGGTVPDLP
EGHRVLVVGQVADDASVRLGCEKIATNADLLRAARAANPGAVLIYKPHPDVEAGLRDGSI
AAEQLADVVVPDSDPMALLDMVHDVWTMTSLMGFEALLRGVKVTTVGAPFYAGWGLTTDL
GAVPVARRQARPSLMGLVHAALIDYPRYMDPVSGLPCQVELVVERLAKGDIPAPGTANRT
LAKLQGLLATYTHLWR